General Information

  • ID:  hor006321
  • Uniprot ID:  Q91082
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Lepisosteus osseus (Long-nosed gar) (Esox osseus)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lepisosteus (genus), Lepisosteidae (family), Semionotiformes (order), Holostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGRKRRPVKVYPNGVEEESAEAYPTEM
  • Length:  39
  • Propeptide:  MLRSVWVYSLGLAVLLQQSGREQCWEHSQCRDLSSEENILECIQACNSDLTAESPIFPGNGHLQPPSEADRNYAKSHFRSTALGRRTNGSVGSSKQAGENAALSILFAALAPPQAEEEMEESESSQQQRREDKRSYSMEHFRWGKPVGRKRRPVKVYPNGVEEESAEAYPTEMRRDLMSDLDYPLLEEVEEELGGENEVLNLQEKKDGSYKMHHFRWSRPPKDKRYGGFMKSWDERSQKPLLTLFKNVIIKDGHQKKGQ
  • Signal peptide:  MLRSVWVYSLGLAVLLQQSGRE
  • Modification:  T13 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91082-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006321_AF2.pdbhor006321_ESM.pdb

Physical Information

Mass: 527710 Formula: C204H310N58O60S2
Absent amino acids: CDILQ Common amino acids: E
pI: 9.02 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -117.69 Boman Index: -10907
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 34.87
Instability Index: 7297.44 Extinction Coefficient cystines: 9970
Absorbance 280nm: 262.37

Literature

  • PubMed ID:  9268621
  • Title:  Deciphering posttranslational processing events in the pituitary of a neopterygian fish: cloning of a gar proopiomelanocortin cDNA.